SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BHT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BHT0
Domain Number 1 Region: 30-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Cripto EGF-like domain-like 0.007
Further Details:      
 
Weak hits

Sequence:  V4BHT0
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4BHT0
Sequence length 60
Comment (tr|V4BHT0|V4BHT0_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO88329.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_80483 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
CKNGGKLLLRSFCQCPSDFYGTFCQHLSQNRSCGRIMHGAWMESDCNICRCYDGLFHCIP
Download sequence
Identical sequences V4BHT0
XP_009060944.1.39240 jgi|Lotgi1|80483|gw1.53.173.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]