SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BJX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4BJX6
Domain Number - Region: 23-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0526
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4BJX6
Sequence length 134
Comment (tr|V4BJX6|V4BJX6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO88839.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_165259 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MKVLLVLDICCLIGLVSVGEAVCPDNCNYNGVCDVKHSRCNCYEGFTGSDCKTDCRCNGH
GTCQSGSVCKCDEGWKYSGGQCVWDCHCLNGAKCIGPGECGCVHNCKMGNCRNGQCQCWN
GYKGSDCSEYDPTM
Download sequence
Identical sequences V4BJX6
jgi|Lotgi1|165259|fgenesh2_pg.C_sca_50000100 XP_009060509.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]