SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BJY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BJY3
Domain Number 1 Region: 2-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 2 Region: 83-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 3 Region: 41-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4BJY3
Sequence length 120
Comment (tr|V4BJY3|V4BJY3_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO88854.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_75648 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
VQQCKPTEFRCASGDCVEGSYRCDGQIDCIDNSDEIGCSNICKDEEFKCRSGDCIDIFLI
CNGRIECPDGSDEDDCPVGPSGTCRDDEFRCIDGTCINFNFRCDSRSDCPDGDDEFGCRK
Download sequence
Identical sequences V4BJY3
jgi|Lotgi1|75648|gw1.50.131.1 XP_009060420.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]