SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BNC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BNC9
Domain Number 1 Region: 35-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000204
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4BNC9
Sequence length 94
Comment (tr|V4BNC9|V4BNC9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO90349.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_123418 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MTPNSRKGPISVEANCFGPRSVLFTALVTYLLFSSDIDECATNNGSCEYKCQNEPGSYNC
SCPEGSELQENGLNCGPSEPGKVVIHYILYRNIT
Download sequence
Identical sequences V4BNC9
XP_009059020.1.39240 jgi|Lotgi1|123418|e_gw1.44.27.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]