SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BP31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BP31
Domain Number 1 Region: 10-203
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-39
Family Nuclear receptor ligand-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4BP31
Sequence length 207
Comment (tr|V4BP31|V4BP31_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO90689.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_122846 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MLDKLPSNPTEFANIAEGFVRRIIKVTKHIVNFKKLCKDDQICLLKGAVVDVMMLRSAVN
YDPSTESWSLSTMSYDSNRISADILKCGGRETMEMFKSYSKFIKSLMSTIRGDLLMLKIL
IVMAIFSTDRGDLVDSGFVQKIQEEYAEILQKYIQSRFPEEKTLFAQVVMKLTDLRNIND
VHTKMLLKMRVEDVEPLLIEIFDLPCP
Download sequence
Identical sequences V4BP31
jgi|Lotgi1|122846|e_gw1.42.378.1 XP_009058681.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]