SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BTS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BTS9
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.09e-21
Family Fibrinogen C-terminal domain-like 0.00069
Further Details:      
 
Weak hits

Sequence:  V4BTS9
Domain Number - Region: 114-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000326
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4BTS9
Sequence length 348
Comment (tr|V4BTS9|V4BTS9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO92354.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_162660 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MAYRQFFLKLFVILCYTRALYATVDLRKFTTCKDHYASCRIREQWTAVKVFQCYFYCGRN
YWCRALTIKPIAGGVTCTFHEGIFDVNCKSFPFQKNYNYKLLLKNEVYESPDDNGCKNDA
TYNSGNCQCLKGFTGTYCERYVRDCREAKEAGVTLILYQVVHVMIKPTGNNYAFEALCNY
YGYIAILIRHAQGYDVAFNRSFEEYKYPFGMINNYWSGLENIYAVLNQGETFKLQIFCHD
FTTGTMFSVYYNAFHVTSSPNMYQMSVGSILVDPGNEGSDGLGENNNDIPFCTYDKPCNG
YPNNINGGWWYVNGLQKYALTNPKSTVLFKYRHADFSADSVSVSLERL
Download sequence
Identical sequences V4BTS9
jgi|Lotgi1|162660|fgenesh2_pg.C_sca_35000061 XP_009056917.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]