SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BV24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BV24
Domain Number 1 Region: 76-357
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-63
Family Nuclear receptor ligand-binding domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 8-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-29
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4BV24
Sequence length 359
Comment (tr|V4BV24|V4BV24_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO92854.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_120392 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
SNSKKLDALCLVCGDKASGKHYGVQSCDGCRGFFKRSIRRSLDYVCKENGNCTVDVARRN
QCQACRFRKCLDVKMNKDAVQHERAPRYSSPNSNNKLSSNLTSTPIISSFHQPFLTKITP
THPIPPPSFSSPFTSSTSFHLPSSVQEHNSYDNASSENVFETAARLLFMSVKWARNIPSF
LQLPFRDQAILLEESWSELFILSASQWSLPLDAATLLMASGVTSENSATEKSVYISSQIR
SFQDIINRFNSLRVDATEYACLKALILFKSVIFSKINFSETRGLRDPSQTDTLQDQAQLM
MHEYIQSHHPGNKARFGKLLLLLPSLRAVSARTIEDIFFRRTIGSIPIERLLCDMFKSS
Download sequence
Identical sequences V4BV24
jgi|Lotgi1|120392|e_gw1.33.154.1 XP_009056540.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]