SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4BYX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4BYX3
Domain Number 1 Region: 302-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4BYX3
Sequence length 626
Comment (tr|V4BYX3|V4BYX3_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO94324.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_189647 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MTSKVCVSVCLVLGCVFAIYGKVSPIDLDLNLDGKESKDIGFDGLTSLASFSTVSDPKLD
ENSTNAKNAVLPGDIREFSLTQWTAKQEIQPKNGTSFTRVKRASKKGKKKRGKGRKRKGR
KGMKKKKGKKRKGKKKGQKGKTIKKGKKKGKRKKKKGRKGKKGKNVKKLKGKRKGKKRNG
KKKGKKGNGKKKGKKGNGKKKGKKGNCMKNCKKVYDKKKDKGKKIIKSKKEPEGKKESDD
NLKELLEKIKEEKDDAVNSPELKKIYPVKVKIETTMPVNKEKMKEIKELSSIKKKTDKTL
TKIDPCELKPCRHNGICEKLGSTIKDYKCVCPAGRKGKHCEFSAEKIKLKSDQGKPKKHK
KHKAKQEDDANLALIISLSTVIPVTVVIALILTIHCVRVKNKRAQLLAKFRRDKRFGKVP
EPVPGVMALSNQMFCGCCSKQKKKAPAYTIKDIEVELEKQATIEKLNELIDKASGTKASK
LGGGKAKKGIKGGKSDASMMSEGSEGSETAGSSWGSDVSGVYGSEVSGISGSAVSAVSAV
SAVAAPVSEAKASDEQIEQLADKVAEAKLSVEQVDQLTELVQKVSKAKMEQEAQLTELDQ
QVSTAPMEEEQHPPAPPSPPPLPPLP
Download sequence
Identical sequences V4BYX3
jgi|Lotgi1|189647|estExt_Genewise1.C_sca_290426 XP_009055164.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]