SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4C3G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4C3G9
Domain Number 1 Region: 154-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.033
Further Details:      
 
Domain Number 2 Region: 125-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000059
Family EGF-type module 0.029
Further Details:      
 
Domain Number 3 Region: 95-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000714
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  V4C3G9
Domain Number - Region: 61-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000683
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 185-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000776
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 214-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0102
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4C3G9
Sequence length 276
Comment (tr|V4C3G9|V4C3G9_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO96079.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_231826 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MGSFKVYVSMVSIFVLIAMLNSSSSYRYSSRYGSRSRYNYQPSLRKCLSNDILSTLQGTL
CPRANPCKNGGTEQPSGRCVCTDEYTGPTCEEKVNPCKNGGIDLPSVGCVCTFDFTGSTC
EERVNPCQNNGTLLSDGSCNCTVDFTGTLCEERVNPCQNNGTLLSDGSCNCTVDFTGTLC
EERVNPCQNNGTLLPDGSCNCTVEFIGTLCEGRANPCQNNGTLLSDGSCNCTESFGGNSC
GEARCENINYQECRSECGPDYIQVDSYCDGDDVCCN
Download sequence
Identical sequences V4C3G9
jgi|Lotgi1|231826|estExt_fgenesh2_pg.C_sca_230081 XP_009053195.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]