SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4C831 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4C831
Domain Number 1 Region: 852-901
Classification Level Classification E-value
Superfamily G protein-binding domain 1.52e-19
Family Rabaptin-5 0.00081
Further Details:      
 
Domain Number 2 Region: 893-957
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.99e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  V4C831
Domain Number - Region: 150-258
Classification Level Classification E-value
Superfamily Prefoldin 0.000811
Family Prefoldin 0.008
Further Details:      
 
Domain Number - Region: 601-687
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00319
Family Rabaptin-5 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4C831
Sequence length 971
Comment (tr|V4C831|V4C831_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO97854.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_228394 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MTDVDDFGPLESADPVSNDELSKLKQQVATLEDREATLKQELENEFGQKRAKFKDLYLQK
EEELCTIKSKSAEYQETIQKLEKELEKVSGELEGVKTAAALSEVNKQEVIQSIQKQCQQE
IASLQGLLNEAADEATTSMAARYDIERSKLVDLTGRYEEEIQELRSRLGHERTISTGSES
FLTSISKSLKRVGGSLPMPASPGSISNTSLEHNENLEDSMKKAKEDAEVLKSVVLPLEKE
IASLRDQLEQSQKKLAEMQNGDIINGEDRKSPSLPDLEDLSTGEDKVNQLVRYLKAEKAA
RKDLEMFVTVLTTQKNVLNEDTEKVRKELDEVCALLEEEKSNHDSLKQTWQMANDQFLES
QRLMMMDMRRIEGVLSQEQQRQIAELQKLDSDREAQEKKVRELEEAREKQEKQQAEKRRK
ISEERNKLTDINLQKTKDGLDKSKSQSKASLDSTNSDEVDLIDSEVHPSLSTSELSLLSE
DKFLDSGIHDTRSLSDLDTTTTVRISPDKVLNLPTLTEAQMKAITDLTPEVEARKSLLAV
AKSKSDNLSLEGKRLVSEREWKLLQQEMKTSREKLGRPCHMCTNYEAQLQTVQTEFKEAT
SEAQKLDRHLKSEKTASENQQKYIAELEEAIKTKADEVFGLISSLQNKLSESEKYLVQTK
QQSVQSQLQLQDQLKTLTESRQEVQKELNKLQEENESLMGKHSKTAQQLQNEDINLPDNM
EEMQLLLLKYREEIIAAKVAKEHLEDTLRSEILFLKDQVVSEQQEKNNIEETLTQEIHGL
QEKQACFESIQSELERESAVRAEFETKFRENELALKNLQAKNKQLISVLQQRVEEFDKAK
VKFEEESQASRSKIQSLQIDLDNSEAVQRDFVKLSQSLQIQLEKIRQAENEVRWQHEDDV
DECMNCKQVFSVTKRKHHCKHCGKIFCNDCITKTVASGRNLRASKVCDVCHTILVKDATP
YFCTEPPASPD
Download sequence
Identical sequences V4C831
XP_009051695.1.39240 jgi|Lotgi1|228394|estExt_fgenesh2_pg.C_sca_20372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]