SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4C9G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4C9G2
Domain Number 1 Region: 2-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000148
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 38-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4C9G2
Sequence length 92
Comment (tr|V4C9G2|V4C9G2_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO98379.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_98463 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
SCNKVKCYNGGTCVNNSIDRFYCRCRGSYTGILCQVQYCDLKPCDQGTCLLDTVNSNYKC
ECHHGFWGTRCTMNSILCSSNRCSGNGQCTGS
Download sequence
Identical sequences V4C9G2
jgi|Lotgi1|98463|gw1.19.462.1 XP_009051073.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]