SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4CDE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4CDE6
Domain Number 1 Region: 448-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000182
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4CDE6
Sequence length 581
Comment (tr|V4CDE6|V4CDE6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO99919.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_158076 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MYNQLLGMSRERDLSLKIYVVGGVCKVLLIDTGGGGLDKDHWGTNFVLTFPKLTDYKNKN
MVVITAREVTEVRVTSHQTGEVSAFSLSEGEAGRVIYGNEVETASYGVKLEDLAISVVAS
NKISVYAYGYSAHSTEGMLILPVPSLGIDYLVANFYNQTSSTQTIIIAADNNTEVNIQFK
LEANTHCDVGFNGFYDGDNFDFILNDHDVLNINCECDNTGSRITSNKPIGVITGNRNVKL
PMTSRIDPIMEMLPPVTELGTQFSLIAPTGHTSQKSMLRVVSLNSGTSFEIKGELYTPLK
GEAVDIKYLSQSEKICFNATDKVIVVIFMLGDPVSWYYDGDAYMSVVPPIDRATNDYMVF
NNALKSLDDYYKGGVNIVARNSVTDAIIPSLNYDQLCTGYNVHSEIIGDSQVKHYHAPSP
FLLLIYGYSIREAFGFPAGMKLSVFSGTDECASFPCQNGGWCIDTTTSFRCHCEDSRYTG
THCEIGKANIPILPFTVIIQNIPCLNIIIIISSTTKIIIVIVVVVRSKKLSRSSLFNNKQ
AIHHHHQHYHHHHHHHHHHHHPHHNHHHHHNLDNHRDSRSG
Download sequence
Identical sequences V4CDE6
XP_009049359.1.39240 jgi|Lotgi1|158076|fgenesh2_pg.C_sca_16000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]