SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4CLN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4CLN6
Domain Number 1 Region: 249-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000762
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4CLN6
Sequence length 358
Comment (tr|V4CLN6|V4CLN6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP03220.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_237823 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MGFQVGLCELGPWNEWCEDNVKIASYLTPFKFFGTDKRRAKIYAQMNFYKQFPQPPLKQL
HKRVTAACDKGVVPCMVEIKNTAVQSRAFQPSVGQFHPFPTELEEFQYKLSASYYMCYFT
VNRKSSLRHILAGANCLEKIQGSGLIQDFTSNPKYFTLRDVRTDQVPFQCAELFYCPEPC
YALSSHGLMSYYYDKDTDTSNPCHDIEYNKECKWMEGANTDIYSLMAGKFNFTCNCQEGT
ESGYEWNLKYKICVDVDECFTKQATCPRNQLCINTKGSYFCHCKRGFKYNAARNICEEDN
SVINFAELRKKKKIKSSEMTFRKQLEILIGLRSSIVIVKPSLIVNIFAVFICFQVLLY
Download sequence
Identical sequences V4CLN6
XP_009046143.1.39240 jgi|Lotgi1|237823|estExt_fgenesh2_pg.C_sca_1180070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]