SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4CLV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4CLV2
Domain Number 1 Region: 137-386
Classification Level Classification E-value
Superfamily L domain-like 9.3e-46
Family Internalin LRR domain 0.0036
Further Details:      
 
Domain Number 2 Region: 83-143
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000105
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Weak hits

Sequence:  V4CLV2
Domain Number - Region: 60-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Follistatin (FS) module N-terminal domain, FS-N 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4CLV2
Sequence length 446
Comment (tr|V4CLV2|V4CLV2_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESP03295.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_176394 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MTIGMTEEARMRKWIVALLLGLVFTAVYVRADEDEDDDEEVEEEEIDVAAVEAGKTTLVN
PCEKKRCRRGEQCIVDEKRQPSCVCYQNCEEETDERYWVCSTKNITYKSDCLLDREHCLC
RRKDAACKNLAEKKVHLDYYGGCREKIQNLNDNLDIRELKLYDNRIKVIENLDHLKELSC
LQLQHNRIRAIGKGLSQLKKIKTLRLDSNLLLKLETSDFISCVQLTSLDLSFNMLDNLSA
LSYLPNLEELSASGNRLRKVNELSRCKGLVELDLSNNRLTDLSGFTNLTHLQILRLSNNQ
ITTLNMSGKLKSLEELDVSANKIKELSPLLTAVPNLQILNISDNNISIWDQVLSLSKLGD
LVELFISGNPFSEENGEKPGYFTELQSVIPQLEILDGALVKKLIGKATAPLMRPMSASTV
VSVRQMDNQLKAVNQELAELQTSISK
Download sequence
Identical sequences V4CLV2
XP_009046018.1.39240 jgi|Lotgi1|176394|fgenesh2_pg.C_sca_1164000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]