SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4KN49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4KN49
Domain Number 1 Region: 31-212
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.35e-69
Family Inorganic pyrophosphatase 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4KN49
Sequence length 216
Comment (tr|V4KN49|V4KN49_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ39330.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10001628mg OC=Eutrema.
Sequence
MSEETYEETQETSQSPRPVPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEIT
KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGC
FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNE
NKKVAVNDFLPSESAHEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences V4KN49
Thhalv10001628m|PACid:20189208 XP_006397877.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]