SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4M2T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4M2T3
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.02e-28
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 204-313
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000391
Family Calsequestrin 0.081
Further Details:      
 
Weak hits

Sequence:  V4M2T3
Domain Number - Region: 447-572
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000434
Family Calsequestrin 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4M2T3
Sequence length 581
Comment (tr|V4M2T3|V4M2T3_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ49177.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10020374mg OC=Eutrema.
Sequence
MGIVRTRLAISVILVSTLLLSNAEAKTVDPYKVLGVSRDAKQREIQKAFHKLSLKYHPDK
NKNKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGQPGFDPGFHGGNGGYSYSSNGGQ
SGGFNFGGPGGWQNMGGGGGSKSFSFSFGGGGPSASSFGFGMDDIFSMFSGGSSKGRDQF
GGFGGFGGSSKAESGSKSGTVATIRTINPQVYKKEIVDQGMTWLVLSYLPSQRGTQYHDS
IIEEVAESLQGALKVGRINCETESSLCKQLGIIPRRAPRLFVYSYTSSGKATLAEYTEEL
VAKKVKSFCQEHLPRFSKRIDLDTFDVSALSSQKTPKVMLLSTKKDTPVIWRVLSGLYNG
RFVFYNTEVHDTFDPKIRELGVDAFPAILGWFSNGEKQVLKTGITVKNLKSAVQEIGKLL
EGFEKKNKKVASNSQSGQAQSQPLEKIHLLSRTNFDSICGEKTPVCIIGAFRSSHGKEKL
QSILSKVSQKSLSRRQASATGSQDTVSYSLLDAAKQSSFLSSLDKSEMKTSDKLLIAYKP
RRGKFATFKGDMTMEEVEKFVAAVLNGDIQFTKTRQKPQLK
Download sequence
Identical sequences V4M2T3
Thhalv10020374m|PACid:20183750 XP_006407724.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]