SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4N7Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4N7Z1
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 203-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-18
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4N7Z1
Sequence length 352
Comment (tr|V4N7Z1|V4N7Z1_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ41796.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10015705mg OC=Eutrema.
Sequence
MVKNSGFGQIMQEGDNPGFFKILRKEDLSSEIMRMIPHQFIRSISDNSSSFKMVLKLPWG
SSWPVKISKNPSFHYMEDRGWNRFVSDNALGENEYLTFTHEANMCFNVNIYEPDGTEMLR
PRESATIASSSGLNKREQRKEVKTEEIIESSSESSYPGLNKAESAGSRLKKKRELNLGKK
KAEKTGKPKKKKVDSAAGTSSLVPEFNLTIKKSHLLYFAIPKNFVDMHMPKKTKLFKIHP
EGENSWEVLYLVTGVQSRFSAGWSRLAKDLGLVVGDVCTFKLIKPTEMLLKVSRDGDDDA
DDDDDDADDDDDDDADDDDDDADDDDDDADDDDDDDDDDDDDDDDDDDDDDV
Download sequence
Identical sequences V4N7Z1
XP_006400343.1.70970 Thhalv10015705m|PACid:20206714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]