SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4RVR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4RVR3
Domain Number 1 Region: 12-174
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.1e-62
Family Inorganic pyrophosphatase 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4RVR3
Sequence length 179
Comment (tr|V4RVR3|V4RVR3_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR38883.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10026346mg OC=Citrus.
Sequence
MLYVLIFAGPGAPAVCNCVVEIGKGGKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPR
TICEDSDPMDVLVLMQEPVLPGSFLRCRAIGLMPMIDQGEKDDKIIAVCADDPEFRHYKD
IKELPPHRLAEIRRFFEDYKKNENKKVDVEDFLPAEAAIEAIKYSMDLYASYIVESLRQ
Download sequence
Identical sequences A0A067G5X3 V4RVR3
XP_006425643.1.91645 orange1.1g030332m|PACid:18099032 orange1.1g030340m|PACid:18099031 clementine0.9_023324m|PACid:19284486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]