SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4SJ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4SJ65
Domain Number 1 Region: 27-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.49e-67
Family Inorganic pyrophosphatase 0.00000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4SJ65
Sequence length 214
Comment (tr|V4SJ65|V4SJ65_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR38885.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10026346mg OC=Citrus.
Sequence
MSNHLGTAGSNNSGGPPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKG
GKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGSFL
RCRAIGLMPMIDQGEKDDKIIAVCADDPEFRHYKDIKELPPHRLAEIRRFFEDYKKNENK
KVDVEDFLPAEAAIEAIKYSMDLYASYIVESLRQ
Download sequence
Identical sequences A0A067FUE6 V4SJ65
clementine0.9_021575m|PACid:19284484 clementine0.9_021591m|PACid:19284485 orange1.1g028079m|PACid:18099028 XP_006425645.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]