SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V5R0G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5R0G3
Domain Number 1 Region: 43-104
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.14e-29
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000094
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.59e-18
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V5R0G3
Sequence length 104
Comment (tr|V5R0G3|V5R0G3_9ARCH) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AHB23951.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSFISAYHMCAGEAAVADLAFTAKHAGLIEMSEMLPARRARGPNEPGGLSFGHMC
DIVQTSRKFRDDPCKIALETCAAAMMLYDPIWLGGYMSGGVGFT
Download sequence
Identical sequences V5R0G3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]