SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V5V3F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5V3F0
Domain Number 1 Region: 2-360
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.17e-101
Family Cystathionine synthase-like 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V5V3F0
Sequence length 379
Comment (tr|V5V3F0|V5V3F0_9CYAN) Serine--glyoxylate aminotransferase {ECO:0000313|EMBL:AHB87910.1} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_02780 OC=Thermosynechococcus.
Sequence
MLMIPGPTPVPESVLLSLSKHPIGHRSGDFSEIMAAVTAGLKWLHQTTNDVLILTASGTG
AMEAGIINFLSAGDRVLVGCNGKFGDRWGEVCDAYGLKTERITAPWGQPLNPDDFKAALE
ADTAKTIKAVIVTHSETSTGVINDLEAINRHVKAHGQALIIVDAVTSLGAVNVPIDEWGL
DVVGSGSQKGYMIPPGLAFVSVSAKAWEAYKTATLPKFYLDLGKYRKDAAKNTTPFTPPV
NLFFALKTALEMMQAEGLDSIFARHQRLMQATRAAMKALNLPLYAPDDCASPAITAVAPQ
GVEAEKIRNLMKKRFDIALAGGQDHLKGQIFRIGHLGFVSDRDILAAISALEAVLGELGY
SNFTPGAGVAAASRVLTAA
Download sequence
Identical sequences V5V3F0
gi|571027305|ref|YP_008899423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]