SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V5V6L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5V6L0
Domain Number 1 Region: 6-221
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.59e-77
Family D-ribulose-5-phosphate 3-epimerase 0.0000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V5V6L0
Sequence length 231
Comment (tr|V5V6L0|V5V6L0_9CYAN) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_08755 OC=Thermosynechococcus.
Sequence
MSAKPVVIAPSILSADFSRLGEEIQAVDRAGADWIHVDVMDGRFVPNITIGPLIVEAIRP
LTQKPLDVHLMIVEPEKYVADFAKAGADIISVHAEHNASPHLHRTLCQIRELGKQAGVVL
NPSSPLELIEYVLEVCDLVLIMSVNPGFGGQKFIPAVLPKIRRLRQLCEERGLDPWIEVD
GGLKVDNTWQVLEAGANAIVAGSAVFHAPDYAAAIAGIRNSKRPSPELVTA
Download sequence
Identical sequences V5V6L0
WP_024125405.1.87165 gi|571028413|ref|YP_008900533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]