SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V6VDH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6VDH6
Domain Number 1 Region: 16-205
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-68
Family BPHL domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V6VDH6
Sequence length 206
Comment (tr|V6VDH6|V6VDH6_9BACI) Uncharacterized protein {ECO:0000313|EMBL:ESU72508.1} KW=Complete proteome OX=1408282 OS=Geobacillus sp. MAS1. GN=T260_07755 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MSMFGKVAADVLGLSDIGSVIQPKDYDKVDADDYVMHEDGEKIYFLIKSKSDEYCFTNRA
LIHLDGTSAASKKRTLRRYDYYKHPISDVSLETAGTVDLDAEIKFKIGSHCYSIDVHKKH
IEELKDLYKSLLAIAEICHENEMKFHYAERSLELAVKVFANMRGDGVNVSADFQAVNEYA
FCWLTEAKKNYTVKDFGFVFDKYIQQ
Download sequence
Identical sequences G8N0G7 V6VDH6
gi|375009324|ref|YP_004982957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]