SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V7BLQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7BLQ5
Domain Number 1 Region: 337-438
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7BLQ5
Sequence length 911
Comment (tr|V7BLQ5|V7BLQ5_PHAVU) Uncharacterized protein {ECO:0000313|EMBL:ESW18887.1} KW=Complete proteome; Reference proteome OX=3885 OS=Phaseolus vulgaris (Kidney bean) (French bean). GN=PHAVU_006G079300g OC=Phaseoleae; Phaseolus.
Sequence
MGSDICVVNGSCTHEWRKGWPLRSGGFAQLCCKCGFMEEWKGDILEPLSTYENSVFCSKF
HHQQTGWRECNFCNKPIHCGCMVSRSLFEHLDYGGIGCVSCVNTSQLSTMRNIENPNGPV
SLIKNNASDRPSSHSEGRLFARGVDEGKLMQFCKIIEASESSRWNNAQRDGIISRHGHNN
QEAKCSFGEGDIGFSNVMKPSVQSLTFATLENNRSPWEIKNIHEANVQPSLSMYLGNASG
NNSVLPSAGEAVEGRLEGKPSPPFHQGQRSRPIFPKPLKSGLTMNVEIDKGTISQSRVAR
PPADGRGKNQLLPRYWPRITDQELERLSGDLKSTVVPLFEKVLSASDAGRIGRLVLPKAC
AEAYFPSISQSEGVPLRMQDVKGNEWTFQFRFWPNNNSRMYVLEGVTPCIQAMQLRAGDT
VTFSRIDPGGKLVMGFRRASNSADTQDTSTSAQSNSAKGTTSAGTENLPSGSSHANLLLS
MKGGNVEPHLNGQREHLHLGTGTSELLITENNGMTNNSSVQQKFLSLEKKKTRNIGPKSK
RLLIDNEDARELKLTWEEAQDLLRPPPSVKPSIVTIEDQVFEEYDEPPVFGKRTIFSTCS
SGVKEQWAQCDDCSKWRKVPIDALLPANWTCFDNAWDSIRCSCTVPEELSSGELENLLKT
DKDFKKRRSDEKSKSIQEHEASGLEALACAAALGENLVDTAESSAGATTKHPRHRPGCSC
IVCIQPPSGKGRHKPTCTCNVCLTVKRRFKTLMLRKKKRQSEREAEAAQKDQVLQKEESD
TNETSRDDATQLEKEVVGLSRSQAEGGESSAAGQIDLNSHPNREDMQVDITGVMFCETDP
STVREYMNQNGPRSYNNELQNGENSSLHTSQSNVEGQRHFSDLRSFASIMWNQERRDEED
SEPNQSQNNLC
Download sequence
Identical sequences V7BLQ5
Phvulv091029828m|PACid:23556109 Phvulv091029829m|PACid:23556110 XP_007146893.1.22112 XP_007146894.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]