SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V7PGL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7PGL4
Domain Number 1 Region: 113-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.42e-59
Family RecA protein-like (ATPase-domain) 0.0000000218
Further Details:      
 
Domain Number 2 Region: 43-98
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000816
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7PGL4
Sequence length 352
Comment (tr|V7PGL4|V7PGL4_9APIC) DNA repair protein RAD51 homolog {ECO:0000256|RuleBase:RU364139} KW=Complete proteome OX=1323249 OS=Plasmodium yoelii 17X. GN=YYC_04711 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MPAMKSANAKEDTISQTCDNSTTEDVDEHLYTGPLKIEQLLAKGFVKRDLELLKEGGLQT
VECVAYAPMRTLCSIKGISEQKAEKLKKACKELCNSGFCNAIDYHDARQNLIKFTTGSKQ
LDALLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRP
ERIVAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADTRFALLIVDSATALY
RSEYTGRGELANRQSHLCRFLRGLQRIADIYGVAVIITNQVVAKVDAMSMFGGHEKIPIG
GNIIAHASQTRLYLRKGRGESRICKIYDSPVLPEGEAVFAITEGGIADYEEK
Download sequence
Identical sequences Q7RI44 V7PGL4
73239.Q7RI44 XP_723988.1.76580 1118.m00048|PY03786|PY03786|Rad51 gi|82539154|ref|XP_723988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]