SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V7PTT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7PTT7
Domain Number 1 Region: 2-239
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.2e-45
Family Duffy binding domain 0.00000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7PTT7
Sequence length 669
Comment (tr|V7PTT7|V7PTT7_9APIC) Uncharacterized protein {ECO:0000313|EMBL:ETB63006.1} KW=Complete proteome OX=1323249 OS=Plasmodium yoelii 17X. GN=YYC_00610 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDYFKQFIYKDAAREGELLLNKYDDKNNNEYCNDMINSFGDYKNIVEGTGLKNVANESLL
ELKIQNIFGTDDNAKRNRKTWWKNHEHIVWKAMVLGKNFNETSNYKNVCTNYKLEDYHSQ
IERWTREWIQEFSVQYFKEANKINNKCTKKSNISTESICINNECKNACNTYEAWISVNKS
KWDTLLQRFSQFNKSYFSEETCRDKAYNSLMIEFKEAYEANFENVINLDDDHYTGLCVCS
SVKPSNTPINNNLGYKQTLETQNPTDASQNTLFPPFSTGTETDLFKEDDDDNGGFDLLSY
NNADAQNLRNSTPTDQVGVNNEQNKLNQNAESNNKYELQIMGNHANSDNTYHNIIIPSQE
NNIYTSTPESVTINPTSTSNTNENQTLTPNSTLTPTLTSNSNPTQIPTQPQPQFPIPPQP
QFPIPPETQFPIPPETQIPTPTLNPNATNKGVKEHHFNTNGIENGNTMKDQMNIPPIKFN
IDPKHDNTINGGFSRINNDNDSENANKLGINEYEHRDIKKSRENIIMLANENVCNGNPGL
KYCESINNKYFHGTCSKSQTQNLCCSISNYCIKFFNINSKKYYDCMNEEFMAPDYNCFQK
ESYSNQYYYATGGIIFVIIFICASIGFSGNKSEEEAFNNYEEYLYKSYNQSTLNNGFKRV
QEYIPVDFY
Download sequence
Identical sequences V7PTT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]