SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V8P3C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V8P3C7
Domain Number 1 Region: 311-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.56e-26
Family UBX domain 0.015
Further Details:      
 
Domain Number 2 Region: 68-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000151
Family Thioltransferase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V8P3C7
Sequence length 563
Comment (tr|V8P3C7|V8P3C7_OPHHA) UBX domain-containing protein 4 {ECO:0000313|EMBL:ETE68503.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_05701 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
FVTCVRAHRRVRGKRTAGGSGGWSGEGRAQRFSLSRLLSLSGSLFLPPXPNTPRSSSARG
VDAADAAIMLWFPGTIPAAIGAAKQRSAVFVVFVQGQDEQSTEMAASWENAKVSEAATDN
FVAIKIDTQSEACLQFSQIYPVVCIPSSFFIGDNGIPLEVIAGSVSAEELIARIHKVKQM
HLIKTEGLESSASCSSSLCSNPEDSQSQTAETSETELERLRLTPDEGEVNLVQTNEKDDR
RVEQTTDDLAAKVERVTQKLEERREEKKKEEEQKEIKKEIERRKSGKEMLEYKRKQEEEL
TKRILEERNREKAEDKAARERIRQQIALDRAERAARFARSKEEAEAAKAAALQAKQAEME
ARKETSQKEKSAIARIQFRLPDGSSFTNSFPSDAPLEEAHRFAAQIVGNTYGNFSLATMF
PRREFTKDDYEKKLSDLGLAPSASIVLLPAGRPATAVVQSSSGDLWKFLGTILYPLIAVW
RFISNFLFTSPPSSQPPARHHQQQHSNPSAPSTAEPNRQAVRKRVLEKRNEEFKKEGKIY
RLRTQDDGEDDNNTWNGNSTQQM
Download sequence
Identical sequences V8P3C7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]