SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V8PEE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V8PEE9
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.01e-31
Family BAR domain 0.00000309
Further Details:      
 
Domain Number 2 Region: 151-211
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V8PEE9
Sequence length 214
Comment (tr|V8PEE9|V8PEE9_OPHHA) Endophilin-A1 {ECO:0000313|EMBL:ETE72373.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_01790 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
MEIMAKTIEYLQPNPGPALGDVGEAMRELSEVKDALDINVKQNFIDPLQNLHDKDLREIQ
HHLKKMEGRRLDFDYKKKRQGKVPDEEIRQALEKFDESKEIAESSMFNLLEMDTRREYQP
KPRMTLELSDNNQHNGGLSNATTPKPSGGVAMDQPCCRALYDFDPENEGELGFKEGDVIT
LTNQIDDNWYEGMIHGQSGFFPINYVEILVPLPH
Download sequence
Identical sequences V8PEE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]