SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9E4Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9E4Q9
Domain Number 1 Region: 132-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.26e-30
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 254-378
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-29
Family cAMP-binding domain 0.0000731
Further Details:      
 
Domain Number 3 Region: 9-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9E4Q9
Sequence length 394
Comment (tr|V9E4Q9|V9E4Q9_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETI34069.1} KW=Complete proteome; Reference proteome OX=1317065 OS=Phytophthora parasitica P1569. GN=F443_19336 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MTDAEGVQQELQDYLHKKGINTLFINLVESLLLAKPENPILHIIQYLQTNYPEEATPRLK
PGVKDDNPASPRSQYHSDDSESEDEDEGGDAVGEIAASVPPPKIMAKGRRTSVSAETIDP
LSARQFERVVHPKSAEEREGISRMVAENILFKSLDEKQHDIVLDAMFPKEFEPGDIIIKQ
GDDGDNFYILESGICEVYKDGVLVQTCTEAMSFGELALMYNAPRAATVKAVQHSKAWALD
RQTFKFIIMETTLKKREAHKGFIERVPLLESLSEYERLTVADALKTETFSDGEVIITQGD
DGNLFYIIEEGVAVCTKQLSPADAAVEMGELTSGAYFGEIALLTTRPRQATVTAKGKVKC
LTLDRKTFKRVMGPLEDILKRNIDKYNSVIANNI
Download sequence
Identical sequences A0A080Z8B7 A0A0W8CV36 V9E4Q9 W2MD97 W2QXL1 W2W1X9 W2YBK5
XP_008897221.1.635 XP_008897222.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]