SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9FRN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9FRN8
Domain Number 1 Region: 344-472
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.94e-25
Family Chaperone J-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000558
Family Ubiquitin-related 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9FRN8
Sequence length 476
Comment (tr|V9FRN8|V9FRN8_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETI53423.1} KW=Complete proteome; Reference proteome OX=1317065 OS=Phytophthora parasitica P1569. GN=F443_03619 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEGGIWAFYYLQGEDGEDRSHPNAFKLTGISPGTDVTLTDVLRSFPLRNPSAFHFRFRLN
SSKGNTFYWLDVTQPTQKVPLAGGRVICKLLRLERPQKPGLVFRRRPVLKWASGSQPPKR
QGSSNALGDSSNSVQSAKAVQPLGESSNFHRSSSSPGFEQGRPAKYSDRAPGSGNGAESR
HSNSSSRTSSTSGDKKPVSRTGSGSKTTEAQGNLEDFLSGGQKASGAAATPTPSPPKKDV
NLMSDSGWTDAPATPAQPANATSDFLNSMDPLAARATPAQPSPSKAVQRDPPKFDDDNGQ
TVGPVTMAEMEAHSKSTSDGSNVYNPNLVDKSTKSDDVRRAMEERERQVQRDVERAREDL
RKREEAVRNMAAMKDSASAVLGPRLKAWAEDNGRVKNIRTLLSTMHQVMWEDCKWTEVNM
GKLIQPNDIKKHYRKAMIVVHPDKSGGRNAEQLLIAERVFAALNTAWEDFQKTNPC
Download sequence
Identical sequences V9FRN8 W2ZV69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]