SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9HWN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9HWN8
Domain Number 1 Region: 39-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-54
Family Glutathione peroxidase-like 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9HWN8
Sequence length 221
Comment (tr|V9HWN8|V9HWN8_HUMAN) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} OX=9606 OS=Homo sapiens (Human). GN=hCG_22448 OC=Catarrhini; Hominidae; Homo.
Sequence
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK
YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR
WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
Download sequence
Identical sequences O75715 V9HWN8
ENSP00000392398 ENSP00000450365 NP_001500.1.87134 NP_001500.1.92137 ENSP00000392398 ENSP00000450365 gi|4557629|ref|NP_001500.1| ENSP00000392398 ENSP00000449271 9606.ENSP00000392398 9606.ENSP00000393902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]