SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9KC26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9KC26
Domain Number 1 Region: 538-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 118-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 58-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 493-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000404
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9KC26
Sequence length 584
Comment (tr|V9KC26|V9KC26_CALMI) Complement component C8 beta subunit {ECO:0000313|EMBL:AFO95271.1} OX=7868 OS=Callorhinchus milii (Ghost shark). GN= OC=Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Sequence
MGTAHRSCGLFHPVSCVALLLTVFDIGQRCGASEDLSTVSGGQSRVRRAPWDPPQPLDCL
LSAWSPWSLCEPCQNKRFRYARLEVPRQFGGEPCETFDRQEETCRSRSRCHVPDMCEGFV
CAETGRCIARRLLCNGDDDCGDRSDERSCRRLQVACSGHREQYWGVQYLGSGFNILTETL
QGPVLDNSYYAGSCAPHYIKNVRFRKPHNLELHSPETKADFQLSLQEHESFSSFAESRFK
SSKKSKAFKLAINIPEVFEIGINYASNNYRKMASKLLESSGAKRSMYHAQMTLQVGRFKF
KLRDLMLHHEFFQRISELPIPYSYGEYREIYKDYGTHFMSEGFLGGTYEYLWVLNSKNMK
RDGYSMSDAENTMKVGANLGGSIDGIYVAGGFTFGIGDKLLTEKGVGIASSNYTEDFIAF
VRGGASEHVTALSQKDLPTRQLMQEWGDAVEYNPEVIQFKPVPLYQLVTGQTFHNSRAIK
ANMKRALEEFLTEYSSCRCAPCRNNGAVVFTGSHCECVCPPGFRGVACEITNRRDVPVDG
KWSCWSGWSECTGRQKTRARSCINPPPAHGGQPCPGDRQETLTC
Download sequence
Identical sequences V9KC26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]