SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9KV95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9KV95
Domain Number 1 Region: 76-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 37-78
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000706
Family Somatomedin B domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9KV95
Sequence length 262
Comment (tr|V9KV95|V9KV95_CALMI) RPE-spondin-like protein {ECO:0000313|EMBL:AFP02492.1} OX=7868 OS=Callorhinchus milii (Ghost shark). GN= OC=Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Sequence
MGDAGQWLLLAGLLWLSELTDGGCSESGKCCKGRDHGCGGPGWRADRVYGTCYCDEACQS
TGDCCYDYTRTCPARPCVVSEWSHWSGCAEQCQPNVRVRRRYIEQEPQNHGDPCPALEER
AGCLEYMNYQGIHCGLSHVPAFISTAEYNKERRKRALVEESEISEYCTEFKLESLSFHCT
VENRPFARWMQYLREGYTVCVACQPPAMNTGSHRCIGDGAEDYGTDTFQWQAVGNNRCRG
TWKKVRQVPQCSCPVVHSFVFT
Download sequence
Identical sequences V9KV95
XP_007885169.1.63211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]