SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9XSG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9XSG3
Domain Number 1 Region: 377-687
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.07e-69
Family Duffy binding domain 0.00000000000684
Further Details:      
 
Domain Number 2 Region: 103-372
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.62e-57
Family Duffy binding domain 0.0000000000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9XSG3
Sequence length 741
Comment (tr|V9XSG3|V9XSG3_9APIC) Erythrocyte-binding antigen 175 {ECO:0000313|EMBL:AHD25484.1} OX=880534 OS=Plasmodium sp. gorilla clade G1. GN=EBA-175 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KNDKKIFSFIENKLDILNNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLS
TSSLIKQNKYVPINAVRVSRILSFLDSKINNGRNTSSNNGDLSNCREKRKGMKWDCKKKN
DTSNYVCIPDRRIQLCIVSLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCN
DLKYSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGGVSEHQIKNFRKQWWNEFRK
KLWEAMISEHKNNISNCKNIPEEELQITQWIKEWHGEFLLERNNRSKLPKSKCKNNTLYE
ACEKECIDPCMKYRDWIIRSKFEWHTLSKEYETQKVSKENAENYLIKISKNKNDAKVSLL
LNNCDAEYSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTEV
WECKKPYILSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKN
KDDKEVCKIINKTFADIRDIIGGTDYWNDLSNRKLVGKINTNSNYVHRNKENDKLFRDGW
WKVIKKDVWNVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQDKTKMIENLKVECK
EKPCEDDNCKSKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKK
YSEKCSNINFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEENTEIAH
RTETGTDERKNQEPPNKDLRN
Download sequence
Identical sequences V9XSG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]