SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W1P625 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W1P625
Domain Number 1 Region: 19-112
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.84e-28
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 190-302
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000026
Family Calsequestrin 0.032
Further Details:      
 
Weak hits

Sequence:  W1P625
Domain Number - Region: 437-559
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0522
Family Calsequestrin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W1P625
Sequence length 570
Comment (tr|W1P625|W1P625_AMBTC) Uncharacterized protein {ECO:0000313|EMBL:ERN05312.1} KW=Complete proteome; Reference proteome OX=13333 OS=Amborella trichopoda. GN=AMTR_s00007p00161340 OC=Amborellaceae; Amborella.
Sequence
MSAFFLFFVFSTFVLVAFSIDPYKVLGVDRDASQRDIQRAFHKLSLKYHPDKNNDKSAQA
KFSEINNAYEILSDEEKRKNYDLYGDEKGGPNLGSGNPGGPGDRSTYFTYGGPGSGNFNF
RPGGSHQARPSFGNPSGSSSSFSFDFSGSNFAENIFSTFFGGGNPNGGNLFGGFGSSQGP
KSGHGSTPPSNVQPINSKVFAKEVADEGLTWLLLFYTPSSNGYENAESILEDVANSLHGA
LKAGSVNCKDEKAFCKERGVWPLKSNRIFVYSYRSNEKGSLVEYKGDWNFKNLKSFCQDH
LPRFSKRVELTELDHFLRTATNDLPKVILLSRKKETPVIWRVLSGLYHKRYAFYDTEVHD
SSDPKVRSLGVKALPAILGMMSNGQKHVLSSGIVVKDLKNGVSELRGILENFEKKNKKAG
AFGKTTKSSPSEARDEKVPLLEKENVETVCGESAALCIIGVFRSSRSRESLASILSTMSQ
KTLTRGQYHGGRDPVSYCLLDASRQAQFLNAFDKSGFKSQDKLLVAYKPRRGKFVVFSDD
FTLEEVERFIGSVLNGDTELKKILRKPELR
Download sequence
Identical sequences W1P625
XP_006843637.1.86515 ERN05312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]