SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2L743 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W2L743
Domain Number 1 Region: 18-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.03e-48
Family PAPS reductase-like 0.0000619
Further Details:      
 
Domain Number 2 Region: 273-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000137
Family Thioltransferase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W2L743
Sequence length 355
Comment (tr|W2L743|W2L743_PHYPR) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:ETL93273.1} KW=Complete proteome OX=4792 OS=Phytophthora parasitica (Potato buckeye rot agent). GN=L917_08530 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MTATLFDESQYSSLEVYADALNAQLERKTAQEIVQWTFDTFGERTVLSSSFGIQSAVMLH
LTRSVSKNIPVVWVDTGYLPKETYQFAAHLTKLLDLDVRVYQSPITPARMEALYGKLYEI
ETPEAHRQYGFMRKVEPMQHALKELNAAALLVGVRADQTQHRQHMKHVNVYEGRLKICPI
LNWSKQEVEQYMTVNRLEYHPLKAQGYESVGDAHSSRPVTEADKGNFRAGRFNGKQQECG
LHLDMHDMKLEDFKFDDPLALSEQDQELLKLTKRAKGITIFTKPTCKYCLAAKDVMRERE
WEFDEVSVPTEVSIQALQQIVGKPVKTAPQIFLDGKYIGGYTEFVEHLDIPSRFA
Download sequence
Identical sequences W2L743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]