SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2ZW03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W2ZW03
Domain Number 1 Region: 56-97
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W2ZW03
Sequence length 217
Comment (tr|W2ZW03|W2ZW03_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP51483.1} KW=Complete proteome OX=1317064 OS=Phytophthora parasitica P10297. GN=F442_03401 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSAPTSRLQAERLIASAYRIPLFENDGAGDNAAPTVSSGSKLRTLTRLPSRNSTSSSEFY
LQQSGVQFYVDDLVRQLQDKRPDQPAQFIASYFSAVAKGFNVKSRPYEYINGCLQNRVAF
LAQLQRSYAKIDHEIVLSVGDFTEMLRCQCRDLPTQLILQATCHLVEDQDGQRRASLQTF
LAAFSACFFFNEFLNKTHDIYNENSAAKDSNSIRSER
Download sequence
Identical sequences A0A081ATZ6 W2ZW03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]