SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4GPX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4GPX3
Domain Number 1 Region: 27-217
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.54e-48
Family PAPS reductase-like 0.0000569
Further Details:      
 
Domain Number 2 Region: 276-347
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000641
Family Thioltransferase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4GPX3
Sequence length 379
Comment (tr|W4GPX3|W4GPX3_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV81752.1} KW=Complete proteome; Reference proteome OX=112090 OS=Aphanomyces astaci. GN=H257_05344 OC=Aphanomyces.
Sequence
MQTYSADEWTLRGLAPAPTTFSPAYVAHLNTMLRSKSAAEIVAWAANSFGKSLALSSSFG
IQSAVMLHLVTQHANQPHRVPVVWVDTGYLPPETYAFATALQQSLDLNLRVYHPQTSPAH
MEAVHGKLYESSSPEDHQLYGLLRKVEPMERALAEMGATALLVGLRADQTDRRRRLDIVH
VHNGRLKICPILSWTQHDVDTYMARHNLPFHPLKALGYATVGDAHSSRPMTEADTDIRAT
RFHGRAQECGLHAIDTDYDDDADAHEAAQYLPYVDAIVYSKPQCKYCVLAKEALSNAKWS
YRDVTVGVDITLRALCDLVGSDVTSVPQVFVRGQYIGGYDDLHDLLHRSTTKKPFSQDDT
SSRPGFHTNFHINYPSTLA
Download sequence
Identical sequences W4GPX3
XP_009828489.1.97551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]