SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4I6U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4I6U3
Domain Number 1 Region: 820-910,945-1043,1070-1255
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.62e-78
Family Duffy binding domain 0.0004
Further Details:      
 
Domain Number 2 Region: 1-278,314-333
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-75
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 369-699
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.02e-73
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 4 Region: 1249-1468
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-34
Family Duffy binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4I6U3
Sequence length 1651
Comment (tr|W4I6U3|W4I6U3_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW39443.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_06176 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MPPRREHMCTSNLEYLETGEHPFSNNNAKLINDSFLGDVLLSAKFEADFIKKKYKEGKNP
EGFKNNATICQAIRYSFADIGDIIRGRDMWEKENGMQKLRDNLPKIFNKIKDNHKDIKGK
LQYNGDTDHIKLREDWWEANRHQVWRAMKCEIKKDKNMKCNGIPIEDYIPQRLRWMTEWA
EWFCKAQSQAYGELLRDCGSCKGKVQGCTSGDGEVCKQCMTACKKYTTEIQKWENQWTKI
KEKYDELYKKATEGGTASDRKDKDVVAFLKKLHEASGGTSGATRSPYFTAAGYIHHELGR
TVGCNTQKEFCYSKNGKYAFKDPPKGYEEACKCDKNVLKPPEKKEDKKDACTIATNLVKD
NDGEKKINGCGPKTDGKYPGWDCTNKNVKTEHSGACIPPRRRKFCTRLLTKKDVFKTNEE
NIRTEFIKSAAIETHFAWHKYKKDNVNAENELKAGNIPDEFKRQMYYTFGDFRDIFFGTD
ISSCPHIKRTSNTIKSKLGDQTIKAKGGKHPNGKTRQEWWTKHGPEIWEAMLCALEKVGG
NVSIKSTYNYNTVKKDLENFVKRPQFLRWMIEWSEHFCKEQKEEYGKLVAGCNGYECNGE
NGKDDNKEKCIKACEAYEDYIKKKNKEYTKQEEKFNTDKSNDKEEYNGYSKKKASEYLKE
KCLDGSCSCMEKVKNIDDYWKNPHKTYDDNKLETKCECPQTPPKPPTAEDSVARSLPPVD
EIDDEDDDEDDDDEVADGTEEAEEEENEEQEEADDDEEEEEDDEEEDEVEEEAESKDVEN
EATSEENPETQQEEVARTTQDTVDVCSIVDKALKVDLNDACNQKYDGKYYGWRCVPTTSG
GSEPTSGDNTGGLCIPPRRRKLYVGKLEQWATKAVSPPEGASPSNPRDGLRDAFIESAAI
ETFFLWDRYKKIKEKEKKEKEEAENHLFAVTLSEPDELDKKLKEGNIPEEFKRQMFYTLG
DYADIFFGKNDILIKNTGSGASDKEMADRERKIKETIDKVFPNNGSSPLPPGQPNSDEQR
KQWWNSNAQDIWEGMICALSYNETKYRIESVHTQLMETTKNTYHYNKVTFKGGFNGDTKL
DDFVKIPTYFRYLEEWGEEFCRKQKHKLYIIEKECKVEANGRGGNEKKPKCSCYGEHCDD
QLPEDPSTDAELKCPGCGRHCRKYKKWINTKRTEYEEQQNAYEQQKTKCQSKSEGGDNGF
CGTVQRCSKAAAFLQKLGPCSKKDSESGQDDQEDEIDFKNESKTFGHETYCKPCSKFKIN
CENGSCSGGETNVGCNVNNKTISAENINNSTDDLYMLVSDNGESGSGFEDDGLGECQHAG
IFTGIRKDVWTCGKVCGYNVCKPVKVDRKANGEKHIITIRGLVEHWVQNFLDDYNKIKHK
ISHCTKNGKGSKCICGCEQKCKCVDKWITKKRTEWENIKNNHLKKNENGENNIKSLIKNI
LEKLQSRPEFQNAIKPCDGLDKFKKSCGLNGDASSEKKGDGKDTVDCLLNKLQEKAKKCA
ENHKPSGKETNCGEYTPPDDEDLPLEEVENENPLQAKKNMMPTICETVVPTEPEEPGETC
TPAATQPEEPAAADSPPARPATEPQSETKSSEEPAKIVPEKKVPEKKDKAPKPQHEPPQP
DLSPLKTALVTSTLAWSVGIGFAAFTYFYLK
Download sequence
Identical sequences W4I6U3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]