SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4I7D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4I7D5
Domain Number 1 Region: 89-392,421-437,466-486
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-84
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 865-949,996-1018,1050-1151,1204-1253,1276-1379
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-79
Family Duffy binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 2111-2468
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-63
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 4 Region: 2515-2783
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-59
Family Duffy binding domain 0.0000605
Further Details:      
 
Domain Number 5 Region: 1721-2025
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.89e-49
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 6 Region: 502-577,610-706,771-791
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-36
Family Duffy binding domain 0.0062
Further Details:      
 
Domain Number 7 Region: 1416-1626
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-30
Family Duffy binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4I7D5
Sequence length 2868
Comment (tr|W4I7D5|W4I7D5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW39342.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_06276 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGPKAAAGSGGKDKSAKEVFDEIGEQIQQEVHVSAIDYISELKGDLSKVVFSNKYKVSTG
DACHLDYTKDTNVTSGGGKENPCEGRQPVRFSDTNGGYCYNSRIKGNDDPKYGGACAPFR
KLHMCDRNLEEIEPEKIESTDNLLVDVLLAAKHEGESLVEKHKEYIKENRDSKICTALAR
SFADIGDIIRGKDLFLGHKQRKKYLEERLGKMFENIQEKNSRLQDLPLDKLREYWWNANR
DQVWKAITCRAGDTDEYFTKSSTREFKFTSGKCGHNDDNVPTYFDYVPQYLRWFEEWAED
FCRKKKHKLKDVKTNCRGKDKSDEYRYCSRNGYDCTKTKPAIGKYRMGNQCTKCLFACNP
YVEWIENQRKQFDKQKKKYETEIRKYENGAPVSGRQRRSAHGGSNVNGYEKIFYDKLKGE
YRTVDKFLNLLNNEKACKDITDGGRINFKEVNSTSGGTAVSDTSGTNNENEGTFYRSKYC
QPCPYCGVRKANNGKWEAKINDDNCKRGNLYKPTSGAEATPINFLYSGDRQAEINKKLEQ
FCKTQIGNGSVPGGASVSNSDSKELYEDWKCYKGKDVEKVNNGQDNDDEDDDEEDVEEVK
NAGGLCILENKNKKEKKSEKEPADIQKTFNNFFYYWVAHMLKDSIHWKKKLERCLQNGNR
IKCGNNKCNNDCECFQNWIKQKKTEWGKIKTHFNTQEGFDNEGENGISVGGLGMTADVVL
EGVLELEFANENSTEDAENNVSAEEAKEIKHLREIIEKKNQEDEAGASDGKKKTIMDKLI
EHEEGIATKCLQKQNECNRQQAAREPAGRSAVPSSPSPAPTANPTESSSEDPEEEEEEEE
DEDEDEVEETASEASEASEVEAPPQQETQPAATKDKVNPCEIVETLFTSGDTALQDACEQ
KYGKTAPTSWKCIPSGDTTSSSGATCIPPRRRKLYVTPLTKWAADEATKRSTSQVNGDGD
SSESSDSDSKQAQQHTAASNSTLTTSATASHASNGDALLTAFVESAAVETFFLWHKYKAE
NTKNKDTQGGGNGEDEENPDTDPETSLKEGKIPDGFLRQMFYTLADYKDILFSGSKDEKS
RDRDIFSGDKEMKEKEEKIKGAIQTFFSNSDNKENSGGPKQPNSGTTPEDWWQKNGQAIW
DGMICALTYTDSDAKGTPQVDPQVKDKLWDESTNKPKNHDYNSVKLEDESGSKQNQTTSS
TSDNTPLTQFVERPPYFRYLEEWGQNFCKERKKRLEEVRKGCRQKHDGGDTFCSGDGHDC
TDPKLKHNDMSADLDCRDCYKQCRKYRKWIDIKFDEFHNQKNKYEGEFQKIKGNNNGGDK
NCCKDIEKHMSAADFLAVLKHCSNDQTDGEKDEEDEKNKIDFEHPEKTFNPSTYCKACPI
YGVTYNTRLKKYKPIDETIYNRKNVIRGENGNDRIPTEIDVLILGREGKNDDKYDENYCK
NAGLFEDASFQKWECQKKNGVDQCKLKNFSDDIDDDEHIVFNEFIQRWLRNFIQDYNKLK
NKISSCIKNEHEISNKCIKDCNNKCECVGNWLKKKEDEWKKIKDLYKQYSNITEQTIAYN
VKSYFVDQGLFDSDYKKAQEVVEGEEAQENLWGNTGINYAISEQTGNNDDFITNLISKLK
QKITSCPYEPGQPQPNCVEIPSPDDEEETSLLDDDTSTQEKMSPDFCPSDMPEKPKTDSD
ILCDGKNEPKCDDFKTYNSNTYKPKIKLIGLGAHNLIARTNSNVYMSPRVRQLCLEQLTK
LAVPTKNADLVTEEQFSEALQECAYNEAKSLYEYYKGEGKGMIPIKDNEKIEDKIKEHIL
EAMKRSYADYGNIVKGDMWWIYPHRRYIDTIIISFAHTFNEKFKSYSVSIDDDAKRLNLW
KSIRTNVWKAMLCGYEKAGGNMNSLPNGEKFCILPSTDEEDQFSRWFKEWGENFCIRREQ
ELKQLKDKCKNGICKITDEGEIQECKSLCERYKEFLKNFESQYEKQRILYIELKESISEF
KNKDPFTFLKEKCNPQFSCFKDINENESNKIFQHASDEIIKFCTCTSTDTSKTTPTNCIE
KAAYELQKEATNKIGSASNSLKIKDNVIDLSDCRKGNYVVVDNGVDGKKIDKDMLKKMFP
SNRYSCEPNEINSFHIGKAWDCNYRNINDRDKNLCLPPRRQFMCMKKIEHISAKDVKDKE
NLLRIVMEIAKEEGIRILRNYQEQNKTQFSEICDDMKYSFADLGDIIRGRDLWKEYPNYH
TTEQNLQRIFKNIHNEITKGGDKDKYKYDRQYFHELRNDWWNTNREAIWKAITCSTPRSA
YIYKKTNTGDKIRSTDMYYYCGYTKEPPYDDYIPQRLRWMKEWGEYVCKILNEKINDIKK
ECDKCKINDKTCSDDDDGNKCKSCKEKCREYNKLIHNLKSQLDIQKEIYKELYKKIKDNG
IRFTTDSDKEVIEFLKEVEKTGCDVKSFDKYLDKTSHCINYKFNEKEKEKETYAFNLNPK
VYKEKCKCGITKDPLDKCPDQNTCTKYHAIQCFGKEHDDNAYWLSTYIKDNKAIIKNVLV
PPRRRHLCLRIYRAKFYHLRKEINNFKEFIFSSAFSEAKRLKKVYKDDNDKLLQAMKYSF
ADIGNIVKGDDMMQSPTSDNIAKIFRGMKYKGIDRTKWWNENKYHVWESMLCGYRKAGGD
TKTNENCRFPDIESVPQFLRWFQEWTENFCIQRKKLYDILVAKCKEAKCDENTCDSDPSE
CTKACRAYENYVLLKKKEYELQKVKYNAQFKGQNDRNEAPQYLKEKCKNGKCACLYEKFN
SDNNWEKPYETLDETVKSKCDCKKVEPPPIQPLPSDEPFDPTILQTTIPFGVALALGSIA
FLFLKVKENIYVWGICLRVGVFGYIYMWMYMYVFYIYFIYIYVFFFRR
Download sequence
Identical sequences W4I7D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]