SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4I866 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4I866
Domain Number 1 Region: 252-350,396-485,540-722
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.76e-72
Family Duffy binding domain 0.00077
Further Details:      
 
Domain Number 2 Region: 719-928
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-38
Family Duffy binding domain 0.006
Further Details:      
 
Domain Number 3 Region: 2-107,134-153
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.12e-24
Family Duffy binding domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4I866
Sequence length 1154
Comment (tr|W4I866|W4I866_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW39325.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_06294 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KFAQTPQFLRWFTEWGEDFCKQRDVKVKELVKQCTGYDCGNTQNGKKEACKNACKKYQEW
LKKWRENYDKQKVKFKTDKEGYNDDPDTIQSTEAYEYLGKKLKNITFTSGTTNGDCNCMK
EKSKQESHDGSITDSMPASLDDEPEEVRGKCTCPPTPPKAQPGGAGRSGTFTPPEEEEEE
EEEVDENEEEEDEDDNSEDTTENKDQEEEETPPGPQDQDAKEPEAEAPPTDHKLNVCSIV
DGILTKDNLEAACKQKYDGKYYGWKCVTPSGKPSDTGSSGATTGGSICVPPRRRKLYVGK
LQEWATKTETQEDGKAQTQTSDQKTPSDKLRDAFIKSAAIETFFLWDRYKKEWTAQKLAE
QEQSGLLLGGVGVPGAGPPQQHGSESDNPQNQLKRGTIPPDFLRQMFYTLGDYRDIYVGN
TDIVSKASSDDKKSMETIEKKIEQILPKNGDTPPPGQNSDKRTALWGDFAQDIWNGMICA
LTYKENGSDKPQVDDKVKGQLFESDGKKPKDTYKYTDVKLNENSGPMHTTQTPSHSGDDP
LNNPKLTQFVERPPYFRYLEEWGQNFCKERKKRLEKIKVDCEVDENTGGRGNGKVCSGYG
EDCKKMLDDDYDTVPSFEYPGCATSCSSYRKWIKGKRKEYDEQQNAYNEQKNSYQRQRNG
AGRNNNDNEFYTKLEKNWNTAASFLQSLKVSCKNDSGNDDIKTEFSNPEITFRPAKNCDP
CSEFNVNCKNCNGGGTKVNCNGGKISAENINNSTDINMLVSDDSATEFKDGLSECKDKGI
FKGIRKDEWTCEKVCGYVVCKPKKVNGETVTKEKDNGKHIVQIRALLRLWLEYFLEDYKK
IKHKISHCTKNREVPTCINGCVEKWVEEKRKEWENIKKRFLEQYKNKDSDNSFPVKTILE
ELIPQIGAANEKNYVIKLSKFGNSCACSASASSTNGNEDAIDCMLQKLQKKIDDCKNKPS
GTDCHPSTPVEDDDEPLEEEKNTEEAKKMMPKICKDVVQEAEAVDEGGCTPDVKKEEEKK
EEKKKPEQTPILKPEEEAPAPEDTEKAKPPEPEAPPAATPKLPKPPKPQRPRRPRRTLEL
LDNPPFKTALMSSTIMWSIGIGFAALTYFLLKVNESIYMYVFSVGVRLDICICFIYIYVF
IIEIEKKKKKEKGI
Download sequence
Identical sequences W4I866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]