SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4I8X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4I8X5
Domain Number 1 Region: 21-52,89-197,244-414
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-60
Family Duffy binding domain 0.00085
Further Details:      
 
Domain Number 2 Region: 404-629
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-41
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4I8X5
Sequence length 799
Comment (tr|W4I8X5|W4I8X5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW40138.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_05487 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
WANNSGNTQESGDKATEASQTSGKETPSGDKLREAFIQSAAIETFFLWDRYKKIKEKERQ
EELQRQQENGLFVDKSSEPDKLDKDLKKGEVPEEFKRQLFYTLADYRDILFSGSKDAKNG
FNYIFSGDKEMKEKEEKIKEAIQKFFEEYGKNQPNNGTPVQTRGNQSPSDDKTPESWWQQ
HGPAIWNGMICALTYEDNGDKGQTPTQDKDLKEKLLDNNTKKPKNEYQYNTVKLDDTSGD
GRTTNDDTKLENFVLRPPYFRYLEEWGQNFCKERKKRLEKIYKDCKVGQGSGKNGQRCSG
YGEDCETNLNKPYNILPDLECRTCGEECTKYKKWINTKKTEYENQQKAYTGQKEKCKEES
GGGGSGFCVTRGTCNEAKDFLQMLGPCKIENGVGKTDFDDDKTFKHTKDCDPCSEFTVKC
SGNNHCDKSKRTNCENKSSIGASDIQNKADCKEVDMRVSDSNTTGFGDLNEACGSADIFK
GIRKEEWECGNVCGYVVCIPKNGNGQKDGEKHIITIRALVTHWVHNFLEDYNKIKDRISH
CMNNGDGTICISGCKNKCNCVDKWIDQKKGEWPKIRDRYIKQYSDKNMDGVYKVRAILED
LQSQIAVTINKAIKPCSGLTAFEDSSHCNGAPNLENANGQKRDAVDCLLDRLKQKIDKCK
QKHAPTSDNSCSTLDNTTPSLEDDDLPLEETEENTVEQPKICPEQAPPKQEEEVEKCEAP
TTPKEPAPPAPSDNEVDNTEQNPDTEAETKSEKEVLPAPAPAAPPPPYLSPPLKTALMTS
TLAWSVGIGFVALSYWLLK
Download sequence
Identical sequences W4I8X5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]