SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4I8Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4I8Y3
Domain Number 1 Region: 261-351,387-483,522-704
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-79
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1086-1370,1406-1450
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-59
Family Duffy binding domain 0.0000964
Further Details:      
 
Domain Number 3 Region: 1448-1768
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-57
Family Duffy binding domain 0.0000863
Further Details:      
 
Domain Number 4 Region: 1-236
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-44
Family Duffy binding domain 0.00036
Further Details:      
 
Domain Number 5 Region: 739-944
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-28
Family Duffy binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4I8Y3
Sequence length 1824
Comment (tr|W4I8Y3|W4I8Y3_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW40126.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_05499 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MMYYTFGDYRDFLFGTDISRKNGDMTKIKNNIDNAFKEKKDNVRKDNNANETFWEENKKL
IWEGMLCGLTYDLTENEKKKILEDTKYQYDTLTPPLEDFAKKPQFLRWMIEWGEEFCAER
KKKEEDVETYCTHVNDHDGCNNKAGKCSKACEAYEDYIKKKNKEYTKQEEKFNTDKSNDK
EEYNGYSKKKASEYLKDKCFPDRCNCIEKVNSITDYWKNPHETYENSTIKNKCECPKPLP
SACSIVETLFTTSDKKHINAACTQKYSGNQSRLGWKCIPTSGGEKSGSSDSNQGSICIPP
RRRKLYLGGFDKFISGEATLSSPSHSRDVDLRNAFIQSAAVETFFLWDRYKKQKEKPQGE
GALGLETLNGGSGDGGEQTPEQQLQSGTIPTDFLRLMFYTLGDYRDLCVGVKDNDVIKAL
EASSDKNIEKIEQKIKSVIENSGDTTPPTQTVPPTSDEKRKKWWDENAKDIWEGMICALT
YDTNSGGKTIEKVNAANGGEDLFEKLKNGNDYETVSFGASGTGAKGNDDPKLTEFVTRPT
FFRWLEEWGEEFCKERKKRLELVKKACREKDDGGDTFCSGDGHDCTDGKRRYNNMFDDLD
CSDCHEKCTDYKKWIEKKLEEFYKQKSKYPNEYEKLKTSSNSHDDEMFYKEVIEKNDYSS
VEKFLESLNHCKNRKDNSEQNNKIDFNEPLKTFSPSTYCKSCPLYGVSCDNKGECKPIEE
HEFKRKNDLDEIKIKKDTSTNIHVQMIDHRGQYIQHPLGNSFKESYLFKSVRDQEWTCRF
IHNKLDECKLNDFNPKIDTDESITFKVLLERWLKDFLEGYYISKRKIETCTKKEENKCIK
GCKNKCKCVDDWLKQKENEWENIKERYKAYYDSPGYEMAYKVRSYFEKHESDVKKSIDDY
EVLKNKDEYEDCNGQNNCTSVDKKRKKDMVTLLLNNLQNEINKCPSSTSVKTSPPCVEPP
PGDEEENVEDTTTNTKPQFCPKDVEEDKKEPPTIADDKTGYKRTGGKSNLPTKPSNCVQI
GAYEIQQKINKETKEIKSKVIGNGLLLDKVCKRVNKNDISNETCDFNKRYSKFPTTLTNK
CNKKGKDRFKIGNLWTCQYIRILKNDVCIPPRRKEMCIDEFSNIGGYKVSDSNELLKKVQ
EAARNEADDIIRKLLQSNPCNEDLICDALKYSFADLGDIIRGRDLLINNTTNDRVERRLR
TIFSKIYNTLGNNAKMKYNDITYYYKLREAWWDTNRKDIWKAMTCAVPEDAKFFKKQPRT
QNGPYKYCGHDKDPPYDDNIPQLFRWMTEWSEYFCKVLDKQMEMVKRECDDCKKNKGTKC
NNDEDGDKCKKCKKQCKEYASLVTKWEKQFVNQQKIYNEFYKEATIKYSRPETVLFKNRK
HTTTTENTKENIIEFIKAIDTLCSYPKSLNDYLHKKSKCENFKFLEQYKTEPEYIFSKNP
NDYDKACKCTGPHPLDDCPKNDKNKNPCTNLSIIKECEKKFFNKDNDDWNSQNIPEFTSK
NKGILVPPRRRHLCLRNITANISSIQNEDDFKNKLIESAYNEGYFLGKTYAKDKQIILQA
MRYSFYDYGDIVKGTDVMDNLKKLHEILKSILKTENGNNQISHDRKNWWTQNKTHVWHAM
LCGYEATQGNFLESDCLLHDDENDQFLRWFQEWIEHFCTKRNQLYQNLENQCKHLECNKN
DEGTGMTTCKRACQEYSNYISTKKHEYELLNYQYEKNFMINLQNKKAPEYYKDKCNNKCN
CFSEYFKDETRWKNPYESFNESTYKDKCDCQKTVPPPLVPPPPPPKSDELPAPADEPFDS
TILQTTIPFGVALALGSIAFLFLK
Download sequence
Identical sequences W4I8Y3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]