SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IAK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IAK5
Domain Number 1 Region: 37-113,153-255,311-490
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-79
Family Duffy binding domain 0.00053
Further Details:      
 
Domain Number 2 Region: 486-694
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.71e-32
Family Duffy binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IAK5
Sequence length 862
Comment (tr|W4IAK5|W4IAK5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW40145.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_05480 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MCIPTNTNEVATGEGSSGNGDRSQRAKRAAPGEPTSGKDTGSICIPPRRRRLYVGKLEEW
AEEATKRSTSQEGGSEASSTSGSTTPPDPKVELLKAFIESAAIETFFLWDRYKKIKEKER
QEELQRQAENGGPQQPDGAIGSEETPENKLKSGKIPNDFLRQMFYTLGDYRDICVGNTPS
GIDTVSASGDNKSGNNIKDISDKIEKILKQSGNNQSRGGPPNSVTTPQQTWWNEHAPSIW
KGMICALTYNTDTTSGEKPTQINEVKQALLDDSGKNEPKKSEYKYDQVKLEDESGAKTNN
AQPPASGDTPTLNNPKLKDFVERPPYFRYLEEWGQNFCKKRTEMLEKIKDDCKVEESSGG
SRRRGGKKCSGYGEHCDDQLGEDPSTLSDLMCQDCGKSCRFYRKWIQRKKTEYEKQKKAY
EQQKKTCQMESNNHDNEFSKTLKSLSEAKDFLKTLGPCKNDNVEGNGKDKLNFTKPEETF
RPATNCKPCSSFKIDCKKANCNGGEKRCNGKKIENDYITASDIENGGNSTVLDMRVSDNS
ANGFKDVLNECKGADIFKGIRKDVWTCGKVCGYVVCKSEKGNGQKDGEKHIITIRALVTY
WVQNFLEDYNKIKHKISHCKNSSEGYTCIKNCVEQWISTKKGEWTNLKSLYLQQYENADE
SYPVKTILEEFKERPEFKNAIKPCDSLDQFKTSCGLNDADSSEKNKEGTKEDNDLVLCLL
DRLKTKVTACPGKPSGDQTKQTCENPSTTLDDEEDLLLEEENTVTQPNICPPQTPPQPEE
TGETCDKAADEKVEETVAQNEESGIPSSPSPSEGTEERPPRPGPQPQPTQPDLSPLKTAL
VTSTLAWSVGIGFATFTYFYLK
Download sequence
Identical sequences W4IAK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]