SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IAL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IAL3
Domain Number 1 Region: 1-266,304-363
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-67
Family Duffy binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IAL3
Sequence length 364
Comment (tr|W4IAL3|W4IAL3_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW40155.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_05470 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MCDRNLEEIKPHQITSTHNLLLDVLLAAKHEGEMITKNLKEYDNANYESKICTALARSFA
DIGDIVRGKDLFLGHKQRKINLENRLQTMFANILNDNTKELGKLTTEQLREYWWALNRDQ
VWKAITCKAKEGDIYSKTANGIISFDFKCGHDNDKVTTNLDYVPQHLRWFQEWAEDFCRK
KNKKLKDAIQKCRGEGGNDKYCDLNGYDCEKTKRGRNIYRWDYKCTGCFLSCSHFRTWID
NQKEQFLKQRNKYQTEISVGGSTSRSGNGGDRRSTTRQRRSAHGGSYDNGYEKIFYEQLK
NDGYGTVNDFLGLLNNEKACKEVKDSEGGKIDFKQVNSGKNSDGDGSNKTFSHTEYCQAC
PLCG
Download sequence
Identical sequences W4IAL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]