SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4ICW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4ICW7
Domain Number 1 Region: 446-765,812-830
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-77
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 927-945,974-1000,1033-1065,1105-1195,1253-1436
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-75
Family Duffy binding domain 0.00056
Further Details:      
 
Domain Number 3 Region: 4-222,267-286
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.19e-52
Family Duffy binding domain 0.00047
Further Details:      
 
Domain Number 4 Region: 1433-1648
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-43
Family Duffy binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4ICW7
Sequence length 2237
Comment (tr|W4ICW7|W4ICW7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW41237.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_04396 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGYKFENDNEGKCRALCRSFADLGDIIKGTDMWEKNSGEQTTQRKLKEIFGKIKKELKE
KLNDKYQDDTEGNKYINLRKDWWEANRDEIWKAMKCQTTPSDTFPCSGTDSGIPFDDYIP
QRLRWMTEWAEWYCKEQSRLYGELVKKCQGCKDKGDKDCIHCTEACKEYTKVVREWENQW
KKMEEKYSKLYKQATTNTDIDEKNKDADVLKFLKQLHKENGGGKSGKSDTVYSTAAGYVH
QEATMNCHTQNQFCEKKNGVKPSNGREDNEYAFRPQPHDHEKECNCQSRNREPPPLRRLL
RLPRYLLRRRPHRLRPLRRGLRSGQVVRGGQVVQVVAVGRVRGRSDRHFVVGEEESETAA
EEEVEEDKDGHDDDDDDHEEPPIIRRNPCAQSGRVQSAKAVMQIAKHFKGMARVEAKGRS
GGLHNLEGDISKAYFRNGGNGSELKGNICKIDNKYSNDIRGTAGGPCTGKGNRFSIGEMW
SHGNFVTENHKDVYMPPRRQHFCTSNLEKLNMNNVTSSSNVNASFLVDVLLAANKEAERS
KDYYENKDHLDACRAIRYSFADLGDIIRGRDMWDKDKGSTDMQNNLKTIFKNIYETIGHN
NGKYKDKDKYLDLRNDWWSANRHHVWKAMQCPTKNGKKFQCGPIPYDDYIPQRLRWMTEW
VEWYCKAQSKLYGELVRDCGECKKNADLCIKDTPNCQKCDKQCKTYGDKIKQWEQQWTKM
DGMYQMIYLFAKNDADSPGPMGYSGDKEEKHVYDFLKELYKLNKASASKRSKRDTTSKSE
IYANAAGYVHQEAHIDDCNTQKIFCKNPINNVDKKKYAFEHPPPDYEKECACENNTTPPP
PTPPPKPTGEDSVARSLQPIARETVTEDSEEEEEDEDDLDDDNGDGQDGGNDDDAGEEVE
AGPPAQDTVEVCTTVAEALTIDTLQDACTQKYGYPQRHWGWKCIPSGSDTGSTTSGEAKI
RQRRDAGDSTGKSDGSICVPPRRRRLYVGGLTKLTSAGTSSESPQESGKAQPQESETTQV
SGSETPSQSSSSSTTPPSNSRAGDLLKAFVESAAIETFFLWDRYKKEKEKEIREKKEQNR
DAGFLDLNDQIAKDPEHPQNKLKNEEIHEEFKRQMFYTLGDYRDICVGVKQDVIKALKDS
GDENIEKINNKIKEILNGEKKQPEKANSGKDRKTWWNENAKHIWNAMVCALTYDTDSGEK
GKPPEQDESLKSALLENGKNTPKTQYEYEKVQLGEEEASGAMPTPETPSSSGENKPTTLD
SFIKRPPYFRYLEEWGQHFCKERKKRLEDIKSNCLDADGIQKICSGDGEDCETMFRQNYE
IFPDFECPSCATPCGLYKRWIKRKKDEFNKQSNAYSEQKKKYEEESNGAESNSNDGNEFY
KKLTTTFKEAKNFLQNLGPCKKDNSEDNGNDHEEDEINFDKPDVTFKHTKHCDPCSQFKI
DCRNGNCKSAVGEECNGKTDITANDIQTMEQPTEDIGILVSDKGSNVFEGDGLEEACKNA
NIFEAIRKDVWTCGNVCGYNVCKPENVNGKKGDGKQIIFIRALFKRWLEYFVQDYNKIRT
KLKPCIENGNASTCINGCNKKCNCVEEWINQKRDEWGKIKNHYLEKNKEGDKNLTSLVKN
FLRDVQPQSDVNKAIKPCGSLTKFESFCGLNRTEISQKKGDTPKDIVECLLKKLEDKANK
CKEDQKPNGEKQANCGEYNLPDDEEDLLLEEENTVEAPNICPEIKPEPVDEGKCEEDTVT
PSLGPKDDSEKDEKKEENSEDTTAAEGEENGAPGSSGTPPPPPAAPPSTPATPAAPIPQP
SDNTSDILATTIPFGIALALGSIAFLFLKKKPKSPVDLIRVLDIHKGDYDIPTLKTSNRY
IPYASDKYKGKTYIYMEGDTSGDDDKYMFLSDTTDITSSESEYEELDINDIYVPGSPKYK
TLIEVVLEPSKSNGNTPSKGDGNTLGDDMVPTTNTFTDEEWNELKHDFISQYIQSEPLDV
PQYDVLKELPMNIVGNVLDDGINEKPFITSIHDRDLYTGEEISYNINMSTNSMDDPKYVS
NNVYSGIDLINDSLSGGEPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNNDPIMNQ
LDLLHKWLDRHRNICENWGKKEDILNKLNEQWNKDNDGGDISSDSNKRLNTDVSIQIDID
ENKGKKEFSNMDTILDDMEHDIYYDVNDDENPSVDHIPMDHNKVDVPKKVHVEMKILNNT
SNGSLEPEFPISDVWNI
Download sequence
Identical sequences W4ICW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]