SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IEC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IEC7
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000000157
Family Duffy binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  W4IEC7
Domain Number - Region: 217-227,373-396
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00889
Family Formin homology 2 domain (FH2 domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4IEC7
Sequence length 684
Comment (tr|W4IEC7|W4IEC7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW41394.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_04232 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKKGEGFTCIKDYDKNHKCVETWISTKRTEWKKIKDHYLEKKHEKGDRDMKSLVRNFLEE
FEDRPEFKKAIKPCKGLTKFESFCGLNGDESSEKKGGKNSDIIDCMIKKLEEKATSCQEQ
HSGSEQCTTPPSNLEDDEEDLLLDEEENTVEAPKFCPEPEKEDVKEEDECKATGTPSKDE
KTKGEEGAPAPPEPPAAEPERTEEAKPPESVEPAPGPPPSPPPPLPPLKTALVTSTLAWS
VGIGFAAFTYFFLKQVHKQLFQSLQMLLHKLLRILLNKYIPYTSGKYRGKRYIYLEGDSG
TDSGYTDHYSDITSSSESEYEELDINDIYVPRAPKYKTLIEVVLEPSGNNTTASGNNTPT
SGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKHDFISQYLQSEQPNGVPNDYKSEDIPFN
TQPNTLYFDKPQEKPFITSIHDRNLLSGEEISYNVNMSTNSMDDIPINSHNNVYSGIDLI
NDSLNNNNVDIYDELLKRKENELFGTEHHPKRTTTNHFATPTRDDPIHNQLELFHKWLDR
HRDMCEKLKNDNERLAKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIHMDNPKTKNEIT
NMDTNPDKSTMDTILDDLEKYNEPYYYDFYEDDIYYDVNDDDKASVDHNKMDNNNSDVPT
NVQIEMNVINNQELLQNEYPISHM
Download sequence
Identical sequences W4IEC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]