SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IEL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IEL2
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-41
Family Duffy binding domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IEL2
Sequence length 4385
Comment (tr|W4IEL2|W4IEL2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW41847.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_03775 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKAMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKEENVSEEIPEGGIAIEDVPVDEETVTEEITVDEKIYD
KLPNEIETVNEEMPVEDETLTEQISSEHERVPEEIIEEKPFTEGEETESLTDEIVEEGVV
TDDIPEEQIITEKVQEEEEFVTGELSEEDIINEKDEVSASKEIVEDEASVTEEVVEEEGA
VSDEVQVTESVEDEIINQGIVDEVIVEQEASVTDEIVKEDESVIEEIAVEETVTEVVEET
KPMDEEIVDQGSVVENEEVSTTEEVKDIGSVSEEVLEEEGFGTEEFVGQQGSVIEEIVET
ESSTEKVLEDVGSNVEEIVQEEGPVAQEIVHEEVSTTEKHDEVDRSTTEEIVEKVGSVSE
EIIVEEVSASEEIVEEGSVTEEVVEEEKLINEVGETESVTEEIVQKEVSDAEEVLGQEGS
MNEEILEKESIVEEIVGPEGSVTEEIVDHGSFAEEVKEEELVTEEAVQYEGSVTEEIKEE
ESITENEAIEESAFAEIIEEKGPNTDEIVKEEGLDTEEIVNEVSVTDEVIEEEKLVNEQI
VGEERSVTEKPVEVERSATEDLVEEEASVTEKVSVHEGSTTEQILDESVAEEIVEEEVSV
DDKIIEEEVSVDEVVEEEGSVIEEIVEEEESVPEEILEEELSGSEEVLEDEWVTDAFMGQ
EGSVIEEIEEIVDGEGSITEEIVEDGSANEKIVEEEPSRVEEVLGKEGFVIEEIIEEGSV
IEQVEDTKTVSEKSEESSAIEEVKEVKEEESISEKIVEKEESVTEEIVRQEESTTEKIVK
DVSPTEDFVEQTDSVTEKVIEQEGSNTEVAEDVEEKESASDEHEQEDVSVNAQVTYEKKS
VTKEIVDEVSRTEEIVEENGSVTEGVDETGSVTEEIIEEATVTEEVVEDGSVTEEVVEDG
SVTEEVVEDGSVIQEVVEDGSVTEEIVQENGSVTEEIVEEEGSVNEEVEEEVSVSGEVDE
TEYVTEEVEEEGSVEGSVVEEIVEEEGSVSEVVDETELVNDEIVEQAPFTEEVEEQVSVN
DEIIEDASVAEAVEESESITESVSQEEETEKGFVIEKVEETGAVTEEIVQDGLITEEILE
ESESVNGEIINKESDAEEILETEFLTEEVVGQAGSTSEEIVEEEGSVTKEVEEKESVTEE
LVDEGSVSVTEELVDEGSVTEEVVEQGGSIAQEIVEEESATEEIIRDETNVEEVLEKEGS
ATEEIVQDGSGTNDFVGKQGSVIEEVVEEEISTTEEKLKEEASAIEEFVEEESIREDVLE
ESLVTENVVGQQESVTEEIVDGEGSFTEDIVEEEESVTEEIVVDEESVTKEIVEDEELVT
EEIVEDEGSFTEEVIEERSLIEEVEDTETVAEKEEGSVIKEIIDEKSLTEKIVEEEKSVT
EEVEEKESVKEEVEEQRLVVEEEGSATEGIVEDRLATEGIVDDILVTEEIVEDGLATDEF
VEQQGSIIEEVLDDEGSVTEEIVEEEGSPNEEIVEGVSVIEEDDNIEPVSEEIVEGSVTE
EMIKEGLENEVILDEDSITEEALEKEGSVSEEIVEEMGSLTEEIVDEERSTSEDMIEEGS
ASEEIIQEESQVEEVVEEVSVIDEIVEEDELDTKEVVEEIEFNTEEVVEHKEEEGSVAEE
IVQEEKEGSVNEEIIEEVGSITEEMVEQDVSDNEEIVEERSVIEEAEENVWIEKEVEEEG
LDNEEVIDEEDSVSEQAEEEVYINEEILKESSDVEDVKVENELMNEEVNEETQSVAENNE
EDKELDNYVVEETESVTEEVVVDEVPNSKEVQEIESIIEEIVEDGLTTDDLVGQQGSVIE
EVVEEVGSDSEEIVEEASITEEVEKKESVTEDILVEESVTGDILVEGSVTEEVVGEEKLV
SEEIVTEEGSVAQEIVEEDAPATEEIDEIESVTEEVVEEEGPVDEEIVQEEGSVTEEIIQ
GESKVEEVVEEQGSENEEIFVEEVSASQEIVQNESEVVEEEGSVTEEIKEQEESVNEEVL
EEVEETESIKEEIVEGGIATQEIIEEESDTKEVVEEEVIDSEKLVDAGSVTGEVMPEEVS
VTDEVVEEGSTTEEVLEEQKSVNEEVVEDGLTIDDFVGLQGSTTEEVVEEDGSAIEKILE
EETATEEIVEKQVSVTEDIVEKEGSVNEEIIEEASVAEEIIQGGSFTEEIVGQEESATEE
VIDEEGLISNEIEEEEEKSVTEEMIEEVEEVSVDDEVEEVSVAEEIVEEELVDDEILPEE
LSATEDVIEEVRSVTDEIVQEESVCEEILEQEVSASEEYVDDKSVTDDFVGHERSVIQDV
ENTESVTEEIAEVDKSVIEEAVEKQGSVTEEKVQEEEELDTEEVLEDKSVTGDVVEQEGS
GKDESEAKESFTEEVDELKSVKEEDQETEYISREIEEESATEQHSEQELSINKEVVETES
LTKDIEEEKSTTQEILEETQSVNEEIVEEERDTDEVLKEKVSPSEEVIEEQASTTEEFVE
ERSSTDEIVEVEDLFTEEVKEREGSVTEEIVEEGSDTGEIVEEEGSDTEEILEEGSFNEE
IVEEEGSITEEILQGSVTEEFVGQQGSVIEEIVETESAIEERVEEESATEEVDERESVTE
VVEEEVSSSDEVVEGSIEEVIENEGSVTEEILEHEVSADENFVGQAVSVIEEVEGTESVT
EEVVEETESVSEEIVEVSPTENVVQQTDSVIEEVVEQKEGSFNEEIDIRELGDDGVEERE
KISTEEVVGQDKSATGDVEESSSTGDVEEVSSTEDEEEVSSTEEEVSSTEGLEEVSNTED
VEEVSSTEDVEEGSVAENVKETKSITEEVSVEEDIITDKVSVEQEVMAEASVEENILTEV
PVEEEIMTEKLSVEDKALNEKIMSEEEIVIEDGNVHEVVPAEVSVTEEIPGVEETTNNES
HVKGENVVNEVVVDDNSVNDEIQFDDDSSIEIYTVDSKDVFHKEENYDSFREEVRSDENI
HIFRKKNENFVKKIENEKSSVGHVPTEYTSKENIAEEVPSHIMFKENVTEEVPKEVKYEE
NTVEEVFEEVTSKENIIEEAPGDINSEENIIEEVPEVVTSEEIVVQNDVNNINTNIDHMF
DFDLDDILKIPEAQKKLNKLRTLVDVHLDVIEKMQRDEWKKNKRDFLYICLKEINKLSED
TLMKFYGSDSNKSANDNDTVMVIKILKDKWGTGRIVDTIANSLNKSYNSLYHNLYIEMEK
DLLINKTETFNKWSKQHWNKLDNWKEEKWFKLFKRDLKIDMRNTYESDQNDEENNEESMN
ELSDELIKNNTSDNMRNEQKTLEKNKEYSNLSKDLGLIEKQKIVWKSWIVKNVNNIENWF
DEMWFKNVVNELKEKNDVSNVLQENASEASVENYISDVEDSKDMTNSINDSEKSKIVASS
SKTTNEEYIILSRKDLIYNIIVMVHMMVLDQFKYDELKYAKKRFLNRSIDKFIKEKKIKD
KETVLDYYIDDIIKRIVEDTSHVNNIKEKAIDHYTSHDWFRLLRQGNKAQNSISQEVDIL
TEKYKKLISEEDNKKENNNNNDDEVKPELKDNIKCEENVSFNILRRSNKKDQLPLEEKKN
KNGDLNNTLTESDGKKININEAIEESKNGNEDKNSGNMEKSRKPRDRRTERKEKDQDLRV
QLLQDYENIFEQIQNMENQNKDKNKKETKNILKTSIDLDKNLLREYKKEKNIINQSEKEF
SVNEN
Download sequence
Identical sequences W4IEL2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]