SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IF89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IF89
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-29
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 135-246
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-22
Family PDI-like 0.018
Further Details:      
 
Domain Number 3 Region: 397-485
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000016
Family Thioltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IF89
Sequence length 507
Comment (tr|W4IF89|W4IF89_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW42331.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_03341 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDYYKRLGVKRNATKEDISKAYRQLAKEYHPDIAPDKEKDFIEIANAYETLSDPEKRKMY
DMYGEDYAQGGMGGGSPGRGEHAHGFHFDQDVVNEIFKQFAGGGGAGASGGRAGNFHFKF
TSGGPSFNHFEDEYEDIYKNEVLKINSKNIESVLNDISFSLIINFYSPTCSHCISFKKKY
LKLRKKFDGYITFAVVNCQEENMLCRKYNVKSLPQLILMRSDKTYETFYGNRTDENLTYF
IKNNIPSAIIECNNQKKLDNFLTQNIEIPKVLFFISHNDNIVMLKALSLEFKKRINIGII
YNTNYSVMKLFKKKNIKTPSLLLVDDIDSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKN
NLYGHVTSYQELTKKKYESGQCHEKDSQICFFILKLLKKNYKSFDEDIKKVANKFSSDPL
KILYINIYQQPYILDSFGLSNNIQYSNGLILVAFRPKRQKFKVYDGDVNVENVHKFVDNV
VSGGIPINQNIKRSLKFVHVEQYDDEL
Download sequence
Identical sequences W4IF89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]