SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4II29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4II29
Domain Number 1 Region: 46-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000585
Family Thioltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4II29
Sequence length 191
Comment (tr|W4II29|W4II29_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW42704.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_02976 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFLLCLLLWRNIICDIKELNYEQFYKMLTTEKNNQKKNYILDKSINYKNFKSFQDFLYIK
TNEDFVLYVYAKWDTDSNNLISIFREVDRILTEHQIKLNFYIFNIDQAKDLCNFLNITSL
PLILYVSSVHKKKYNTLLYKFLNSNKDIKISNAFRYNGDMYCYDYIVEWVEAHYYFTKFV
LLMKKLFSWKK
Download sequence
Identical sequences A0A024W8I7 A0A024WPF5 A0A024X9E4 Q8IJQ8 W4II29 W7F0Q0 W7JXU6 W7K6C0
5833.PF10_0134-1 XP_001347419.1.26446 gi|124802252|ref|XP_001347419.1| gi|23494999|gb|AAN35332.1| PF10_0134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]